Anti-C5orf42
Overview
The Anti-C5orf42 antibody (HPA036776) is a rabbit Triple A Polyclonal reagent directed against human chromosome 5 open reading frame 42 (C5orf42), a large protein associated with developmental processes. The antibody is raised against a recombinant sequence region containing structured and low-complexity motifs. Validated exclusively for immunohistochemistry, it supports localisation of C5orf42 in fixed tissues.
Highlights
- Rabbit Triple A Polyclonal antibody targeting human C5orf42
- Validated only for immunohistochemistry (IHC)
- Recombinant antigen fragment representing mixed structural motifs
- Supplied in PBS with glycerol and preservative
At-a-glance
- Antigen
- C5orf42 (chromosome 5 open reading frame 42)
- Antibody type
- Triple A Polyclonal
- Host species
- Rabbit
- Isotype
- IgG
- Validation
- IHC only
- Immunogen sequence
- LREHELNSLLFDVHTTLKRHQSKTKSQNVFRAGSCFVVAPESYESEKSSSLNDEYGMHLENQKLSSSVLVNQGIKPFLQYPSNEVNKNEGMSGLFG
- Buffer composition
- 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
- Condition
- New
Applications
This antibody facilitates localisation of C5orf42 in human tissues, aiding studies of developmental pathways, ciliary biology, and expression mapping of this large multi-domain protein.
Sustainability
By rehoming surplus lab products, this listing supports waste reduction and resource efficiency.
