Anti-CDH2
Overview
The Anti-CDH2 antibody (HPA058574) is a rabbit Triple A Polyclonal reagent targeting human CDH2 (N-cadherin), a calcium-dependent adhesion protein essential for cell–cell junction formation in numerous tissues. The antibody is raised against a recombinant fragment representing extracellular cadherin domain features. Validated exclusively for immunohistochemistry, it supports localisation of CDH2 in fixed tissue specimens.
Highlights
- Rabbit Triple A Polyclonal antibody recognising human N-cadherin
- Validated only for immunohistochemistry (IHC)
- Recombinant immunogen fragment representing extracellular cadherin motifs
- Formulated in PBS with glycerol and preservative
At-a-glance
- Antigen
- CDH2 (cadherin 2, type 1, N-cadherin)
- Antibody type
- Triple A Polyclonal
- Host species
- Rabbit
- Isotype
- IgG
- Validation
- IHC only
- Immunogen sequence
- NSNDGLVTVVKPIDFETNRMFVLTVAAENQVPLAKGIQHPPQSTATVSVTVIDVNENPYFAPNPKIIRQEEGLHAGTMLTTFTAQDP
- Buffer composition
- 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
- Condition
- New
Applications
This antibody supports immunohistochemical analysis of N-cadherin, enabling studies of adherens junction biology, tissue organisation, and cell adhesion dynamics across human specimens.
Sustainability
By rehoming surplus lab products, this listing supports waste reduction and resource efficiency.
