Anti-FMC1
Overview
This rabbit polyclonal antibody is raised against a protein sequence from human FMC1 (formation of mitochondrial complex V assembly factor 1 homolog). It is part of the Atlas Antibodies Triple A Polyclonals range and is intended for detection of endogenous FMC1 in human tissue samples. The manufacturer reports validation of this antibody for immunohistochemistry applications.
Highlights
- Rabbit polyclonal antibody targeting human FMC1
- Validated application: immunohistochemistry (IHC)
- Immunogen derived from a defined human protein sequence
- Formulated in a glycerol-containing phosphate buffer
At-a-glance
- Target protein
- FMC1 (formation of mitochondrial complex V assembly factor 1 homolog)
- Host species
- Rabbit
- Clonality
- Polyclonal
- Validated applications
- Immunohistochemistry (IHC)
- Immunogen sequence
- ELHFQAATYLCLLRSIRKHVALHQEFHGKGERSVEESAGLVGLKLPHQPGGKGWEP
- Buffer composition
- 40% glycerol, PBS (pH 7.2), 0.02% sodium azide
- Condition
- New / Unused — The product is only validated for IHC application
Applications
This antibody is suitable for immunohistochemical detection of FMC1 in human tissue sections. It may support research into FMC1 expression and cellular localisation. The manufacturer does not report validation for applications beyond immunohistochemistry.
Sustainability
By rehoming surplus lab products, this listing supports waste reduction and resource efficiency.
