Anti-FOS
Overview
This rabbit polyclonal antibody is raised against a protein sequence from human FOS (FBJ murine osteosarcoma viral oncogene homolog). It is part of the Atlas Antibodies Triple A Polyclonals portfolio and is intended for detection of endogenous FOS protein in human tissue samples. The manufacturer reports validation of this antibody for immunohistochemistry applications.
Highlights
- Rabbit polyclonal antibody targeting human FOS
- Validated application: immunohistochemistry (IHC)
- Immunogen derived from a defined human protein sequence
- Supplied in a glycerol-based phosphate buffer formulation
At-a-glance
- Target protein
- FOS (FBJ murine osteosarcoma viral oncogene homolog)
- Host species
- Rabbit
- Clonality
- Polyclonal
- Validated applications
- Immunohistochemistry (IHC)
- Immunogen sequence
- DLQWLVQPALVSSVAPSQTRAPHPFGVPAPSAGAYSRAGVVKTMTGGRAQSIGRRGKVEQLSPEEEEKRRIRRERNKMAAAKCRNRRRELTDTLQAETDQLEDEKSALQTEIANLLKEKEKLEFILAAHRPACKIPDDL
- Buffer composition
- 40% glycerol, PBS (pH 7.2), 0.02% sodium azide
- Condition
- New / Unused — The product is only validated for IHC application
Applications
This antibody is intended for immunohistochemical detection of FOS in human tissue sections. It may support research into FOS localisation and expression patterns. The manufacturer does not report validation for applications beyond immunohistochemistry.
Sustainability
By rehoming surplus lab products, this listing supports waste reduction and resource efficiency.
