Anti-FOXP1 Antibody
Overview
This antibody is raised against a protein sequence from human FOXP1 (forkhead box P1). It is part of the Atlas Antibodies Triple A Polyclonals range and is intended for detection of endogenous FOXP1 in human tissue samples. The manufacturer reports validation of this antibody for immunohistochemistry applications.
Highlights
- Antibody targeting human FOXP1
- Validated application: immunohistochemistry (IHC)
- Immunogen based on a defined FOXP1 protein sequence
- Supplied in a glycerol-containing phosphate buffer formulation
At-a-glance
- Target protein
- FOXP1 (forkhead box P1)
- Host species
- Rabbit
- Clonality
- Polyclonal
- Validated applications
- Immunohistochemistry (IHC)
- Immunogen sequence
- QMQQLQQQHLLSLQRQGLLTIQPGQPALPLQPLAQGMIPTELQQLWKEVTSAHTAEETTGNNHSSLDLTTTCVSSSAPSKTSLIMNPHASTNGQLSVHTPKRESLSHEEHPHSHPLYGHGVCKWPGCEAVCEDFQSFLKHLNS
- Buffer composition
- 40% glycerol, PBS (pH 7.2), 0.02% sodium azide
- Condition
- New / Unused — The product is only validated for IHC application
Applications
This antibody is suitable for immunohistochemical detection of FOXP1 in human tissue sections. It may be used in research examining FOXP1 expression and cellular localisation. Validation is not reported for applications beyond immunohistochemistry.
Sustainability
By rehoming surplus lab products, this listing supports waste reduction and resource efficiency.
