Anti-GAS8 Antibody
Overview
This antibody is raised against a protein sequence from human GAS8 (growth arrest-specific 8). It is part of the Atlas Antibodies Triple A Polyclonals portfolio and is intended for detection of endogenous GAS8 in human-derived samples. The manufacturer reports validation of this antibody for Western blot analysis.
Highlights
- Antibody targeting human growth arrest-specific 8
- Validated application: Western blot (WB)
- Immunogen derived from a defined GAS8 protein sequence
- Supplied in a glycerol-containing phosphate buffer formulation
At-a-glance
- Target protein
- GAS8 (growth arrest-specific 8)
- Host species
- Rabbit
- Clonality
- Polyclonal
- Validated applications
- Western blot (WB)
- Immunogen sequence
- VEKKEVQFNEVLAASNLDPAALTLVSRKLEDVLESKNSTIKDLQYELAQVCKAHNDLLRTYEAKLLAFGIPLDNVGFKPLETAVIGQTLGQG
- Buffer composition
- 40% glycerol, PBS (pH 7.2), 0.02% sodium azide
- Condition
- New / Unused — The product is only validated for WB application
Applications
This antibody is suitable for Western blot detection of GAS8 in human-derived samples. It may be used in research investigating GAS8 expression and relative protein abundance. Validation is not reported for applications beyond Western blot.
Sustainability
By rehoming surplus lab products, this listing supports waste reduction and resource efficiency.
