Anti-GJA1 Antibody
Overview
This antibody is raised against a protein sequence from human GJA1 (gap junction protein alpha 1, 43 kDa), also known as connexin 43. It is supplied as part of the Atlas Antibodies Triple A Polyclonals portfolio and is intended for detection of endogenous GJA1 in human tissue samples. The manufacturer reports validation of this antibody for immunohistochemistry applications.
Highlights
- Antibody targeting human gap junction protein alpha 1 (connexin 43)
- Validated application: immunohistochemistry (IHC)
- Immunogen derived from a defined GJA1 protein sequence
- Formulated in a glycerol-containing phosphate buffer
At-a-glance
- Target protein
- GJA1 (gap junction protein alpha 1, 43 kDa)
- Host species
- Rabbit
- Clonality
- Polyclonal
- Validated applications
- Immunohistochemistry (IHC)
- Immunogen sequence
- EQNWANYSAEQNRMGQAGSTISNSHAQPFDFPDDNQNSKKLAAGHELQPLAIVDQRPSSRASSRASSRPR
- Buffer composition
- 40% glycerol, PBS (pH 7.2), 0.02% sodium azide
- Condition
- New / Unused — The product is only validated for IHC application
Applications
This antibody is suitable for immunohistochemical detection of GJA1 in human tissue sections. It may be used in research examining gap junction localisation and intercellular communication. Validation is not reported for applications beyond immunohistochemistry.
Sustainability
By rehoming surplus lab products, this listing supports waste reduction and resource efficiency.

