Anti-GOLGA5 Antibody
Overview
This antibody is raised against a protein sequence from human GOLGA5 (golgin A5). It is supplied as part of the Atlas Antibodies Triple A Polyclonals portfolio and is intended for detection of endogenous GOLGA5 in human-derived samples. The manufacturer reports validation of this antibody for Western blot analysis.
Highlights
- Antibody targeting human golgin A5
- Validated application: Western blot (WB)
- Immunogen derived from a defined GOLGA5 protein sequence
- Formulated in a glycerol-containing phosphate buffer
At-a-glance
- Target protein
- GOLGA5 (golgin A5)
- Host species
- Rabbit
- Clonality
- Polyclonal
- Validated applications
- Western blot (WB)
- Immunogen sequence
- SSVNPSVTTIKTIEENSFGSQTHEAASNSDSSHEGQEESSKENVSSNAACPDHTPTPNDDGKSHELSNLRLENQLLRNEVQSLNQEMASLLQRSKETQEELNKARARVEKWNADHSKSDRMTRGLRAQVDDLTEAVAAKDSQLAVLKV
- Buffer composition
- 40% glycerol, PBS (pH 7.2), 0.02% sodium azide
- Condition
- New / Unused — The product is only validated for WB application
Applications
This antibody is suitable for Western blot detection of GOLGA5 in human-derived samples. It may be used in research examining Golgi apparatus structure and protein trafficking. Validation is not reported for applications beyond Western blot.
Sustainability
By rehoming surplus lab products, this listing supports waste reduction and resource efficiency.
