Anti-GPA33 Antibody
Overview
This antibody is raised against a protein sequence from human GPA33 (glycoprotein A33), a transmembrane protein expressed in epithelial tissues. It is supplied as part of the Atlas Antibodies Triple A Polyclonals portfolio and is intended for detection of endogenous GPA33 in human tissue samples. The manufacturer reports validation of this antibody for immunohistochemistry applications.
Highlights
- Antibody targeting human glycoprotein A33
- Validated application: immunohistochemistry (IHC)
- Immunogen derived from a defined GPA33 protein sequence
- Supplied in a glycerol-containing phosphate buffer formulation
At-a-glance
- Target protein
- GPA33 (glycoprotein A33)
- Host species
- Rabbit
- Clonality
- Polyclonal
- Validated applications
- Immunohistochemistry (IHC)
- Immunogen sequence
- TYECSVSLMSDLEGNTKSRVRLLVLVPPSKPECGIEGETIIGNNIQLTCQSKEGSPTPQYSWKRYNILNQEQPLAQPASGQPVSLKNISTDTSGYYICTSSNEEGTQFCNITVA
- Buffer composition
- 40% glycerol, PBS (pH 7.2), 0.02% sodium azide
- Condition
- New / Unused — The product is only validated for IHC application
Applications
This antibody is suitable for immunohistochemical detection of GPA33 in human tissue sections. It may be used in research examining epithelial marker expression and tissue localisation. Validation is not reported for applications beyond immunohistochemistry.
Sustainability
By rehoming surplus lab products, this listing supports waste reduction and resource efficiency.
