Anti-KIAA0319L Antibody
Overview
This antibody is raised against a protein sequence from human KIAA0319L (KIAA0319-like). It is supplied as part of the Atlas Antibodies Triple A Polyclonals portfolio and is intended for detection of endogenous KIAA0319L in human-derived samples. The manufacturer reports validation of this antibody for immunocytochemistry applications.
Highlights
- Antibody targeting human KIAA0319L
- Validated application: immunocytochemistry (ICC)
- Immunogen derived from a defined KIAA0319L protein sequence
- Supplied in a glycerol-containing phosphate buffer formulation
At-a-glance
- Target protein
- KIAA0319L (KIAA0319-like)
- Host species
- Rabbit
- Clonality
- Polyclonal
- Validated applications
- Immunocytochemistry (ICC)
- Immunogen sequence
- KRKSKYKILDATDQESLELKPTSRAGIKQKGLLLSSSLMHSESELDSDDAIFTWPDREKGKLLHGQNGSVPNGQ
- Buffer composition
- 40% glycerol, PBS (pH 7.2), 0.02% sodium azide
- Condition
- New / Unused — The product is only validated for ICC application
Applications
This antibody is suitable for immunocytochemical detection of KIAA0319L in human-derived cell samples. It may be used in research examining protein localisation and expression in cellular models. Validation is not reported for applications beyond immunocytochemistry.
Sustainability
By rehoming surplus lab products, this listing supports waste reduction and resource efficiency.
