Anti-MEGF9 Antibody
Overview
This antibody is raised against a protein sequence from human MEGF9 (multiple EGF-like-domains 9). It is supplied as part of the Atlas Antibodies Triple A Polyclonals portfolio and is intended for detection of endogenous MEGF9 in human tissue samples. The manufacturer reports validation of this antibody for immunohistochemistry applications.
Highlights
- Antibody targeting human multiple EGF-like-domains protein 9
- Validated application: immunohistochemistry (IHC)
- Immunogen derived from a defined MEGF9 protein sequence
- Supplied in a glycerol-containing phosphate buffer formulation
At-a-glance
- Target protein
- MEGF9 (multiple EGF-like-domains 9)
- Host species
- Rabbit
- Clonality
- Polyclonal
- Validated applications
- Immunohistochemistry (IHC)
- Immunogen sequence
- YQNRKLNAPFWTIELKEDNISFSSYHDSIPNADVSGLLEDDGNEVAPNGQLTLT
- Buffer composition
- 40% glycerol, PBS (pH 7.2), 0.02% sodium azide
- Condition
- New / Unused — The product is only validated for IHC application
Applications
This antibody is suitable for immunohistochemical detection of MEGF9 in human tissue sections. It may be used in research examining EGF-like domain–containing proteins and their roles in cellular signalling. Validation is not reported for applications beyond immunohistochemistry.
Sustainability
By rehoming surplus lab products, this listing supports waste reduction and resource efficiency.
