Anti-MYOG Antibody
Overview
This antibody is raised against a protein sequence from human MYOG (myogenin, myogenic factor 4), a basic helix–loop–helix transcription factor involved in skeletal muscle differentiation. It is supplied as part of the Atlas Antibodies Triple A Polyclonals portfolio and is intended for detection of endogenous MYOG in human-derived cell samples. The manufacturer reports validation of this antibody for immunocytochemistry applications.
Highlights
- Antibody targeting human myogenin (MYOG)
- Validated application: immunocytochemistry (ICC)
- Immunogen derived from a defined MYOG protein sequence
- Supplied in a glycerol-containing phosphate buffer formulation
At-a-glance
- Target protein
- MYOG (myogenin, myogenic factor 4)
- Host species
- Rabbit
- Clonality
- Polyclonal
- Validated applications
- Immunocytochemistry (ICC)
- Immunogen sequence
- RLPKVEILRSAIQYIERLQALLSSLNQEERDLRYRGGGGPQPGVPSECSSHSASCSPEWGSALEFSANPGDHLLTADPTDAHNLHSLTSIVDS
- Buffer composition
- 40% glycerol, PBS (pH 7.2), 0.02% sodium azide
- Condition
- New / Unused — The product is only validated for ICC application
Applications
This antibody is suitable for immunocytochemical detection of MYOG in human-derived cell samples. It may be used in research examining myogenic differentiation, muscle development, and transcriptional regulation in skeletal muscle cells. Validation is not reported for applications beyond immunocytochemistry.
Sustainability
By rehoming surplus lab products, this listing supports waste reduction and resource efficiency.
