Anti-NFKB1 Antibody
Overview
This antibody is raised against a protein sequence from human NFKB1 (nuclear factor of kappa light polypeptide gene enhancer in B-cells 1), a key transcription factor involved in immune and inflammatory signalling. It is supplied as part of the Atlas Antibodies Triple A Polyclonals portfolio and is intended for detection of endogenous NFKB1 in human tissue samples. The manufacturer reports validation of this antibody for immunohistochemistry applications.
Highlights
- Antibody targeting human NFKB1 transcription factor
- Validated application: immunohistochemistry (IHC)
- Immunogen derived from a defined NFKB1 protein sequence
- Supplied in a glycerol-containing phosphate buffer formulation
At-a-glance
- Target protein
- NFKB1 (nuclear factor of kappa light polypeptide gene enhancer in B-cells 1)
- Host species
- Rabbit
- Clonality
- Polyclonal
- Validated applications
- Immunohistochemistry (IHC)
- Immunogen sequence
- GTGSTGPGYSFPHYGFPTYGGITFHPGTTKSNAGMKHGTMDTESKKDPEGCDKSDDKNTVNLFGKVIETTEQDQEPSEATVGNGEVTLTYATGTKEESAGVQDNLFLEKAMQLAKRHANALFDYAVTGDVKMLLAVQRHLTAV
- Buffer composition
- 40% glycerol, PBS (pH 7.2), 0.02% sodium azide
- Condition
- New / Unused — The product is only validated for IHC application
Applications
This antibody is suitable for immunohistochemical detection of NFKB1 in human tissue sections. It may be used in research examining immune responses, inflammatory signalling pathways, and transcriptional regulation mediated by NF-κB. Validation is not reported for applications beyond immunohistochemistry.
Sustainability
By rehoming surplus lab products, this listing supports waste reduction and resource efficiency.
