Anti-NIPAL2 Antibody
Overview
This antibody is raised against a protein sequence from human NIPAL2 (NIPA-like domain containing 2), a membrane-associated protein belonging to the NIPA family. It is supplied as part of the Atlas Antibodies Triple A Polyclonals portfolio and is intended for detection of endogenous NIPAL2 in human tissue samples. The manufacturer reports validation of this antibody for immunohistochemistry applications.
Highlights
- Antibody targeting human NIPA-like domain containing 2 (NIPAL2)
- Validated application: immunohistochemistry (IHC)
- Immunogen derived from a defined NIPAL2 protein sequence
- Supplied in a glycerol-containing phosphate buffer formulation
At-a-glance
- Target protein
- NIPAL2 (NIPA-like domain containing 2)
- Host species
- Rabbit
- Clonality
- Polyclonal
- Validated applications
- Immunohistochemistry (IHC)
- Immunogen sequence
- FLVTRNREKEHLQQSYIDFGNIPDTTPERKAWRETN
- Buffer composition
- 40% glycerol, PBS (pH 7.2), 0.02% sodium azide
- Condition
- New / Unused — The product is only validated for IHC application
Applications
This antibody is suitable for immunohistochemical detection of NIPAL2 in human tissue sections. It may be used in research examining NIPA family proteins and their cellular localisation and expression patterns. Validation is not reported for applications beyond immunohistochemistry.
Sustainability
By rehoming surplus lab products, this listing supports waste reduction and resource efficiency.

