Anti-OTUB1 Antibody
Overview
This antibody is raised against a defined protein sequence from human OTUB1 (OTU deubiquitinase, ubiquitin aldehyde binding 1), a deubiquitinating enzyme involved in regulation of ubiquitin-dependent signalling pathways. It is supplied as part of the Atlas Antibodies Triple A Polyclonals portfolio and is intended for detection of endogenous OTUB1 in human tissue samples. The manufacturer reports validation of this antibody for immunohistochemistry applications.
Highlights
- Antibody targeting human OTUB1 (OTU deubiquitinase 1)
- Validated application: immunohistochemistry (IHC)
- Immunogen derived from a defined OTUB1 protein sequence
- Supplied in a glycerol-containing phosphate buffer formulation
At-a-glance
- Target protein
- OTUB1 (OTU deubiquitinase, ubiquitin aldehyde binding 1)
- Host species
- Rabbit
- Clonality
- Polyclonal
- Validated applications
- Immunohistochemistry (IHC)
- Immunogen sequence
- AAEEPQQQKQEPLGSDSEGVNCLAYDEAIMAQQDRIQQEIAVQNPLVSERLELSVLYKEYAEDDNIYQQKIKDLHKKYSYIRKTRPD
- Buffer composition
- 40% glycerol, PBS (pH 7.2), 0.02% sodium azide
- Condition
- New / Unused — The product is only validated for IHC application
Applications
This antibody is suitable for immunohistochemical detection of OTUB1 in human tissue sections. It may be used in research examining ubiquitin signalling, protein turnover, and regulation of cellular stress responses. Validation is not reported for applications beyond immunohistochemistry.
Sustainability
By rehoming surplus lab products, this listing supports waste reduction and resource efficiency.
