Anti-PCDH17 Antibody
Overview
This antibody is directed against human protocadherin 17 (PCDH17), a member of the cadherin superfamily involved in calcium-dependent cell–cell adhesion. It is generated using a defined PCDH17-derived immunogen sequence and supplied as part of the Atlas Antibodies Triple A Polyclonals range. The manufacturer reports validation of this antibody for immunohistochemistry applications.
Highlights
- Recognises human protocadherin 17 (PCDH17)
- Validated application: Immunohistochemistry (IHC)
- Immunogen based on a defined region of the PCDH17 protein
- Supplied in a glycerol-containing phosphate buffer formulation
At-a-glance
- Target protein
- PCDH17 (protocadherin 17)
- Host species
- Rabbit
- Clonality
- Polyclonal
- Validated applications
- Immunohistochemistry (IHC)
- Immunogen sequence
- VNDNAPVIVLPTLQNDTAELQVPRNAGLGYLVSTVRALDSDFGESGRLTYEIVDGNDDHLFEIDPSSGEIRTLHPFWEDVTPVVELVVKVTDHGKPTLSAVAKLIIRSVSGSLPEGVPRVNGEQHHWD
- Buffer composition
- 40% glycerol, PBS (pH 7.2), 0.02% sodium azide
- Condition
- New / Unused — The product is only validated for IHC application
Applications
This antibody is suitable for immunohistochemical detection of PCDH17 in human tissue samples. It may be applied in studies of cell adhesion, tissue organisation, and developmental biology. Use is limited to the application validated by the manufacturer.
Sustainability
By rehoming surplus lab products, this listing supports waste reduction and resource efficiency.
