Anti-PGP Antibody
Overview
This antibody targets human phosphoglycolate phosphatase (PGP), an enzyme involved in metabolite repair and cellular metabolic homeostasis. It is generated against a defined PGP-derived immunogen sequence and supplied within the Atlas Antibodies Triple A Polyclonals range. According to the manufacturer, this antibody has been validated for Western blot analysis.
Highlights
- Recognises human phosphoglycolate phosphatase (PGP)
- Validated application: Western blot (WB)
- Immunogen based on a defined PGP protein sequence
- Formulated in a glycerol-containing phosphate buffer
At-a-glance
- Target protein
- PGP (phosphoglycolate phosphatase)
- Host species
- Rabbit
- Clonality
- Polyclonal
- Validated applications
- Western blot (WB)
- Immunogen sequence
- DTDILLGATCGLKTILTLTGVSTLGDVKNNQESDCVSKKKMVPDFYVDSI
- Buffer composition
- 40% glycerol, PBS (pH 7.2), 0.02% sodium azide
- Condition
- New / Unused — The product is only validated for WB application
Applications
This antibody is suitable for Western blot detection of PGP in human-derived samples. It may support research into metabolic regulation and enzymatic repair pathways. Validation has not been reported for applications beyond Western blot.
Sustainability
By rehoming surplus lab products, this listing supports waste reduction and resource efficiency.
