Anti-PPM1J Antibody
Overview
This antibody targets human PPM1J, a Mg2+/Mn2+-dependent protein phosphatase involved in cellular signalling and regulatory pathways. It is raised against a defined PPM1J-derived immunogen sequence and belongs to the Atlas Antibodies Triple A Polyclonals range. According to the manufacturer, validation is restricted to immunohistochemistry (IHC).
Highlights
- Specific for human protein phosphatase PPM1J
- Validated application: immunohistochemistry (IHC)
- Immunogen derived from a defined protein region
- Supplied in a glycerol-based phosphate buffer
At-a-glance
- Target protein
- PPM1J (protein phosphatase, Mg2+/Mn2+-dependent, 1J)
- Host species
- Rabbit
- Clonality
- Polyclonal
- Validated applications
- Immunohistochemistry (IHC)
- Immunogen sequence
- PEVRVYDLTQYEHCPDDVLVLGTDGLWDVTTDCEVAATVDRVLSAYEPNDHSRYTALAQALVLGARGTPRDRGWRLPNNKLGSGD
- Buffer composition
- 40% glycerol, PBS (pH 7.2), 0.02% sodium azide
- Condition
- New / Unused — The product is only validated for IHC application
Applications
This antibody is suitable for immunohistochemical detection of PPM1J in human tissue sections. It can support investigations into phosphatase-mediated signalling and regulatory mechanisms. No validation data are available for applications beyond IHC.
Sustainability
By rehoming surplus lab products, this listing supports waste reduction and resource efficiency.
