Anti-PLPP3 Antibody
Overview
This antibody targets human PLPP3 (phospholipid phosphatase 3), an enzyme involved in the dephosphorylation of bioactive lipid phosphates and regulation of lipid-mediated signalling pathways. It is generated against a defined PLPP3-derived immunogen sequence and belongs to the Atlas Antibodies Triple A Polyclonals portfolio. According to the manufacturer, this antibody is validated exclusively for Western blot analysis.
Highlights
- Specific for human phospholipid phosphatase 3 (PLPP3)
- Validated application: Western blot (WB)
- Defined peptide immunogen
- Supplied in a glycerol-based phosphate buffer
At-a-glance
- Target protein
- PLPP3 (phospholipid phosphatase 3)
- Host species
- Rabbit
- Clonality
- Polyclonal
- Validated applications
- Western blot (WB)
- Immunogen sequence
- SDLFKTKTTLSLPAPAIRKEILSPVDIIDRNNHHNMM
- Buffer composition
- 40% glycerol, PBS (pH 7.2), 0.02% sodium azide
- Condition
- New / Unused — The product is only validated for WB application
Applications
This antibody is intended for Western blot detection of PLPP3 in human samples. It can be used in studies focused on lipid metabolism, phospholipid signalling, and membrane-associated enzymatic processes. No validation is reported for applications other than Western blot.
Sustainability
By rehoming surplus lab products, this listing supports waste reduction and resource efficiency.
