Anti-PTPRD Antibody
Overview
This antibody targets protein tyrosine phosphatase, receptor type D (PTPRD), a transmembrane receptor-type phosphatase involved in cell signalling and adhesion processes. It is a rabbit polyclonal antibody raised against a defined human PTPRD immunogen sequence. According to the manufacturer, this antibody is validated for immunohistochemistry (IHC) applications.
Highlights
- Recognises human PTPRD (protein tyrosine phosphatase, receptor type D)
- Rabbit polyclonal antibody format
- Validated for immunohistochemistry (IHC)
- Supplied in buffered glycerol-based formulation
At-a-glance
- Target
- Protein tyrosine phosphatase, receptor type D (PTPRD)
- Host species
- Rabbit
- Clonality
- Polyclonal
- Validated applications
- Immunohistochemistry (IHC)
- Immunogen sequence
- GREVELKPYIAAHFDVLPTEFTLGDDKHYGGFTNKQLQSGQEYVFFVLAVMEHAESKMYATSPYSDPVVSMDLDPQPITDEEE
- Buffer composition
- 40% glycerol and PBS (pH 7.2), with 0.02% sodium azide as preservative
- Condition
- New / Unused
Applications
This antibody is intended for the detection of PTPRD in tissue sections using immunohistochemical methods. It may be used to support studies of receptor-type protein tyrosine phosphatases in cellular organisation, signalling pathways, and tissue-specific expression patterns.
Sustainability
By rehoming surplus lab products, this listing supports waste reduction and resource efficiency.
