Anti-PLA2R1 Antibody
Overview
This antibody targets human PLA2R1 (phospholipase A2 receptor 1), a large type I transmembrane receptor involved in phospholipase signaling and cellular uptake processes. The antibody is generated against a defined PLA2R1-derived immunogen sequence and belongs to the Atlas Antibodies Triple A Polyclonals range. The manufacturer reports validation exclusively for Western blot analysis.
Highlights
- Recognizes human phospholipase A2 receptor 1 (PLA2R1)
- Validated application: Western blot (WB)
- Immunogen derived from a specific region of the PLA2R1 protein
- Supplied in a glycerol-based phosphate buffer
At-a-glance
- Target protein
- PLA2R1 (phospholipase A2 receptor 1)
- Host species
- Rabbit
- Clonality
- Polyclonal
- Validated applications
- Western blot (WB)
- Immunogen sequence
- EEKTWHEALRSCQADNSALIDITSLAEVEFLVTLLGDENASETWIGLSSNKIPVSFEWSNDSSVIFTNWHTLEPHIFPNRSQLCVSAEQSEGHWKVKNCEERLFYICKKAGHVLSDAESGCQEGWERHGGFCYKID
- Buffer composition
- 40% glycerol, PBS (pH 7.2), 0.02% sodium azide
- Condition
- New / Unused — The product is only validated for WB application
Applications
This antibody is suitable for Western blot detection of PLA2R1 in human-derived samples. It can support research into receptor-mediated phospholipase signaling and related cellular pathways. No validation data are provided for applications beyond Western blot.
Sustainability
Reusing surplus laboratory reagents helps reduce waste and promotes more sustainable research workflows.
