Anti-POLR1A Antibody
Overview
This antibody targets human POLR1A, the largest subunit of RNA polymerase I, which is responsible for ribosomal RNA transcription in the nucleolus. The antibody is raised against a defined POLR1A-derived immunogen sequence and is part of the Atlas Antibodies Triple A Polyclonals range. Manufacturer validation is reported exclusively for immunocytochemistry (ICC).
Highlights
- Recognises human RNA polymerase I subunit A (POLR1A)
- Validated application: immunocytochemistry (ICC)
- Immunogen derived from a specific POLR1A protein region
- Supplied in a glycerol-based phosphate buffer
At-a-glance
- Target protein
- POLR1A (RNA polymerase I subunit A)
- Host species
- Rabbit
- Clonality
- Polyclonal
- Validated applications
- Immunocytochemistry (ICC)
- Immunogen sequence
- DEVRGKWQDAHLGKDQRDFNMIDLKFKEEVNHYSNEINKACMPFGLHRQFPENSLQMMVQSGAKGSTVNTMQISCLLGQIELEGR
- Buffer composition
- 40% glycerol, PBS (pH 7.2), 0.02% sodium azide
- Condition
- New / Unused — The product is only validated for ICC application
Applications
This antibody is suitable for immunocytochemical detection of POLR1A in human-derived cells. It may support investigations into ribosomal RNA synthesis, nucleolar structure, and transcriptional regulation. No validation data are available for applications beyond ICC.
Sustainability
By rehoming surplus lab products, this listing supports waste reduction and resource efficiency.
