Anti-POU2F3 Antibody
Overview
This antibody targets human POU2F3 (POU class 2 homeobox 3), a transcription factor involved in epithelial cell differentiation and gene regulation. It is generated against a defined POU2F3-derived immunogen sequence and forms part of the Atlas Antibodies Triple A Polyclonals collection. According to the manufacturer, validation is limited to immunohistochemistry (IHC).
Highlights
- Specific for human POU class 2 homeobox 3 (POU2F3)
- Validated application: immunohistochemistry (IHC)
- Defined peptide immunogen
- Supplied in a glycerol-based phosphate buffer
At-a-glance
- Target protein
- POU2F3 (POU class 2 homeobox 3)
- Host species
- Rabbit
- Clonality
- Polyclonal
- Validated applications
- Immunohistochemistry (IHC)
- Immunogen sequence
- LESMHTDIKMSGDVADSTDARSTLSQVEPGNDRNGLDFNRQIKTEDLSDSLQQTLSHRPCHLSQGPAMMSGNQMSGLNASPCQDMASLHPLQQLVLVPGHLQSVSQFLLSQTQP
- Buffer composition
- 40% glycerol, PBS (pH 7.2), 0.02% sodium azide
- Condition
- New / Unused — The product is only validated for IHC application
Applications
This antibody is suitable for immunohistochemical detection of POU2F3 in human tissue sections. It may support studies of epithelial lineage specification, transcriptional regulation, and cell differentiation. No validation is reported for applications beyond IHC.
Sustainability
By rehoming surplus lab products, this listing supports waste reduction and resource efficiency.
