Anti-PRKAR2B Antibody
Overview
This antibody targets human PRKAR2B, the regulatory subunit II beta of cyclic AMP-dependent protein kinase A (PKA), which plays a central role in cAMP-mediated signal transduction. It is generated against a defined PRKAR2B-derived immunogen sequence and is part of the Atlas Antibodies Triple A Polyclonals range. The manufacturer reports validation exclusively for Western blot analysis.
Highlights
- Specific for human PRKAR2B (PKA regulatory subunit II beta)
- Validated application: Western blot (WB)
- Defined peptide immunogen sequence
- Supplied in a glycerol-based phosphate buffer
At-a-glance
- Target protein
- PRKAR2B (protein kinase, cAMP-dependent, regulatory, type II, beta)
- Host species
- Rabbit
- Clonality
- Polyclonal
- Validated applications
- Western blot (WB)
- Immunogen sequence
- GFTVEVLRHQPADLLEFALQHFTRLQQENERKGTARFGHEGRTWGDLGAAAGGGTPSKGVNFAEEPMQSDSEDGEEEEAAPADAGAFNAPVINRFTRRASVCAEAYNPDEEEDDAESRIIH
- Buffer composition
- 40% glycerol, PBS (pH 7.2), 0.02% sodium azide
- Condition
- New / Unused — The product is only validated for WB application
Applications
This antibody is intended for Western blot detection of PRKAR2B in human-derived samples. It may support studies of cAMP signalling, PKA regulation, and intracellular signal transduction pathways. No validation data are available for applications beyond Western blot.
Sustainability
By rehoming surplus lab products, this listing supports waste reduction and resource efficiency.
