Anti-PRPF31 Antibody
Overview
This antibody targets human PRPF31 (pre-mRNA processing factor 31), a component of the spliceosomal complex involved in pre-mRNA splicing and RNA processing. It is raised against a defined PRPF31-derived immunogen sequence and is part of the Atlas Antibodies Triple A Polyclonals range. According to the manufacturer, validation is limited to immunocytochemistry (ICC).
Highlights
- Specific for human pre-mRNA processing factor 31 (PRPF31)
- Validated application: immunocytochemistry (ICC)
- Defined peptide immunogen sequence
- Supplied in a glycerol-based phosphate buffer
At-a-glance
- Target protein
- PRPF31 (pre-mRNA processing factor 31)
- Host species
- Rabbit
- Clonality
- Polyclonal
- Validated applications
- Immunocytochemistry (ICC)
- Immunogen sequence
- SGDSVKTIAKLWDSKMFAEIMMKIEEYISKQAKASEVMGPVEAAPEYRVIVDANNLTVEIENELNIIHKFIRDKYSKRFPELESLVPNALDYIRTVKELGN
- Buffer composition
- 40% glycerol, PBS (pH 7.2), 0.02% sodium azide
- Condition
- New / Unused — The product is only validated for ICC application
Applications
This antibody is suitable for immunocytochemical detection of PRPF31 in human-derived cell samples. It can support studies of RNA splicing machinery, nuclear protein localisation, and post-transcriptional gene regulation. No validation is available for applications beyond ICC.
Sustainability
By rehoming surplus lab products, this listing supports waste reduction and resource efficiency.
