Anti-PRR11 Antibody
Overview
This antibody targets human PRR11 (proline rich 11), a protein implicated in cell cycle regulation and proliferative processes. It is raised against a defined PRR11-derived immunogen sequence and is part of the Atlas Antibodies Triple A Polyclonals range. The manufacturer reports validation exclusively for Western blot analysis.
Highlights
- Specific for human proline rich protein 11 (PRR11)
- Validated application: Western blot (WB)
- Immunogen derived from a defined PRR11 protein region
- Supplied in a glycerol-based phosphate buffer
At-a-glance
- Target protein
- PRR11 (proline rich 11)
- Host species
- Rabbit
- Clonality
- Polyclonal
- Validated applications
- Western blot (WB)
- Immunogen sequence
- LAPVLLRKPSLAKALQAGPLKKDGPMQITVKDLLTVKLKKTQSLDEKRKLIPSPKARNPLVTVSDLQHVTLKPNSKVLSTR
- Buffer composition
- 40% glycerol, PBS (pH 7.2), 0.02% sodium azide
- Condition
- New / Unused — The product is only validated for WB application
Applications
This antibody is suitable for Western blot detection of PRR11 in human-derived samples. It may support investigations into cell cycle control, proliferative signalling, and cancer-related biology. No validation data are available for applications beyond Western blot.
Sustainability
By rehoming surplus lab products, this listing supports waste reduction and resource efficiency.
