Anti-PTPN14 Rabbit Polyclonal Antibody
Overview
This rabbit polyclonal antibody targets human protein tyrosine phosphatase non-receptor type 14 (PTPN14), a regulator of signalling pathways and cell adhesion. It is generated using a sequence-defined immunogen to support selective protein recognition. The antibody is supplied in liquid form.
Highlights
- Rabbit polyclonal antibody against PTPN14
- Defined immunogen sequence
- Validated for western blot (WB)
- Buffered glycerol-based formulation
At-a-glance
- Target
- Protein tyrosine phosphatase non-receptor type 14 (PTPN14)
- Host
- Rabbit
- Clonality
- Polyclonal
- Immunogen sequence
- PMLREKMEYSAQLQAALARIPNKPPPEYPGPRKSVSNGALRQDQASLPPAMARARVLRHGPAKAISMSRTD
- Recommended application
- WB
- Buffer composition
- 40% glycerol and PBS (pH 7.2), with 0.02% sodium azide as preservative
- Condition
- New / Unused — The product is only validated for WB application
Applications
This antibody is suitable for western blot analysis of PTPN14 in human-derived samples. It supports research into tyrosine phosphatase signalling and cellular regulation mechanisms.
Sustainability
By rehoming surplus lab products, this listing supports waste reduction and resource efficiency.

