Anti-PVR Rabbit Polyclonal Antibody
Overview
This rabbit polyclonal antibody targets the human poliovirus receptor (PVR), a cell surface protein involved in cell adhesion and immune-related interactions. The antibody is generated against a defined amino acid sequence to enable selective recognition of the target protein. It is supplied as a liquid reagent for immunodetection applications.
Highlights
- Rabbit polyclonal antibody against human PVR
- Sequence-defined immunogen
- Validated for western blot (WB)
- Supplied in glycerol-based buffer
At-a-glance
- Target
- Poliovirus receptor (PVR)
- Host
- Rabbit
- Clonality
- Polyclonal
- Immunogen sequence
- DVVVQAPTQVPGFLGDSVTLPCYLQVPNMEVTHVSQLTWARHGESGSMAVFHQTQGPSYSESKRLEFVAARLGAELRNASLRMFGLRVEDEGNYTCLFVTFP
- Recommended application
- WB
- Buffer composition
- 40% glycerol and PBS (pH 7.2), with 0.02% sodium azide as preservative
- Condition
- New / Unused — The product is only validated for WB application
Applications
This antibody is suitable for western blot analysis of PVR expression in human-derived samples. It supports research into cell adhesion, immune signalling, and virus–host interactions.
Sustainability
By rehoming surplus lab products, this listing supports waste reduction and resource efficiency.
