Anti-RPL13A Antibody
Overview
This antibody recognises human ribosomal protein L13a (RPL13A), a component of the 60S ribosomal subunit involved in translation and ribosome assembly. It is raised against a defined peptide immunogen to support selective detection. The antibody is supplied in liquid format.
Highlights
- Targets human RPL13A protein
- Sequence-defined immunogen
- Validated for western blot (WB)
- Liquid buffered formulation
At-a-glance
- Target
- Ribosomal protein L13a (RPL13A)
- Host
- Rabbit
- Clonality
- Polyclonal
- Immunogen sequence
- AHEVGWKYQAVTATLEEKRKEKAKIHYRKKKQLMRLRKQAEKNV
- Recommended application
- WB
- Buffer composition
- 40% glycerol and PBS (pH 7.2), with 0.02% sodium azide as preservative
- Condition
- New / Unused — The product is only validated for WB application
Applications
This antibody is intended for western blot detection of RPL13A in human samples. It supports studies of ribosomal proteins and protein synthesis mechanisms.
Sustainability
By rehoming surplus lab products, this listing supports waste reduction and resource efficiency.
