Anti-SBF2 Antibody
Overview
This antibody recognises human SET binding factor 2 (SBF2), a protein associated with phosphoinositide signalling pathways. It is raised against a defined immunogen sequence to support selective detection. The antibody is supplied in liquid format.
Highlights
- Targets human SBF2 protein
- Sequence-defined immunogen
- Validated for western blot (WB)
- Liquid buffered formulation
At-a-glance
- Target
- SET binding factor 2 (SBF2)
- Host
- Rabbit
- Clonality
- Polyclonal
- Immunogen sequence
- NQAPEKWQQLWERVTVDLKEEPRTDRSQRHLSRSPGIVSTNLPSYQKRSLLHLPDSSMGEEQNSSISPSNGVERR
- Recommended application
- WB
- Buffer composition
- 40% glycerol and PBS (pH 7.2), with 0.02% sodium azide as preservative
- Condition
- New / Unused — The product is only validated for WB application
Applications
This antibody is intended for western blot detection of SBF2 in human samples. It supports research into phosphoinositide metabolism and signal transduction.
Sustainability
By rehoming surplus lab products, this listing supports waste reduction and resource efficiency.
