Anti-ZDHHC23 Antibody
Overview
This antibody targets human zinc finger DHHC-type containing 23 (ZDHHC23), a palmitoyltransferase implicated in protein S-acylation and cellular signalling processes. It is raised against a sequence-defined immunogen and is intended for protein detection in denatured samples.
Highlights
- Specific for human ZDHHC23
- Sequence-defined immunogen
- Validated for western blot analysis
- Supplied as a liquid glycerol-based formulation
At-a-glance
- Target
- Zinc finger DHHC-type containing 23 (ZDHHC23)
- Host
- Rabbit
- Clonality
- Polyclonal
- Immunogen sequence
- MTQKGSMKPVKKKKTEEPELEPLCCCEYIDRNGEKNHVATCLCDCQDLDEGCDRWITCKSLQPETCERIMDTISDRLRIPWLR
- Recommended application
- WB
- Buffer composition
- 40% glycerol and PBS (pH 7.2), with 0.02% sodium azide as preservative
- Condition
- New / Unused — The product is only validated for WB application
Applications
Suitable for western blot detection of ZDHHC23 in human-derived samples. This antibody may support studies of protein palmitoylation and membrane-associated regulatory mechanisms.
Sustainability
By rehoming surplus lab products, this listing supports waste reduction and resource efficiency.
