Toll-like receptor 5 (h) pAb
Overview
Also known as TLR5, Toll/Interleukin-1 receptor-like gene 3, TIL3.
Highlights
- Applications: ELISA, Flow Cytometry, IHC, WB
- Host: Goat
- Long-term storage: -20°C
At-a-glance
- Host Species
- Goat
- Immunogen
- Synthetic peptide corresponding to aa 151-181 (D151LSKNQIRSLYLHPSFGKLNSLKSIDFSSNQ181) of human TLR5 (Toll-like receptor 5).
- Recommended Applications
- ELISA, Flow Cytometry, IHC, WB
- Form
- Affinity purified antibody in 10 mM KHPO4, 140 mM NaCl, BSA @ 1mg/ml and 0.1% sodium azide.
- UniProt ID
- O60602
- Storage Condition
- Long-term: -20°C; Short-term: +4°C; Shipping: Blue Ice; For maximum product recovery after thawing, centrifuge the vial before opening the cap. Avoid freeze/thaw cycles. After opening, prepare aliquots and store at -20°C.
- Condition
- Surplus/second-hand; stored under manufacturer-recommended conditions.
Applications
Suitable for ELISA, Flow Cytometry, IHC, WB and related immunological research applications.
Sustainability
By rehoming surplus lab products, this listing supports waste reduction and resource efficiency.
Responsible use & safety
- Require training/authorization before use.
- Handle with appropriate PPE; consult Safety Data Sheet for hazard details.
- Follow manufacturer guidelines for storage and handling.
