Anti-ACAT1
Overview
The Anti-ACAT1 antibody (HPA007569) is a rabbit Triple A Polyclonal reagent generated against human acetyl-CoA acetyltransferase 1 (ACAT1), a mitochondrial enzyme involved in ketone body and lipid metabolism. The antibody is produced using a recombinant human ACAT1 protein fragment, ensuring sequence-defined antigenic specificity. Supplied in an unconjugated format, it is validated exclusively for Western blot applications, enabling detection of endogenous ACAT1 in cell and tissue lysates.
Highlights
- Rabbit Triple A Polyclonal antibody targeting human ACAT1
- Validated specifically for Western blot analysis
- Generated using a defined recombinant ACAT1 antigen sequence
- Unconjugated format suitable for standard immunodetection workflows
At-a-glance
- Antigen
- ACAT1 (acetyl-CoA acetyltransferase 1)
- Antibody type
- Triple A Polyclonal
- Host species
- Rabbit
- Isotype
- IgG
- Conjugate
- Unconjugated
- Validation
- Western blot (WB) only
- Immunogen sequence
- NEQDAYAINSYTRSKAAWEAGKFGNEVIPVTVTVKGQPDVVVKEDEEYKRVDFSKVPKLKTVFQKENGTVTAANASTLNDGAAALVLMTADAAKRLNVTPLARIVAFADAAVEPIDFPIAPVYAASMV
- Condition
- New
Applications
This antibody is suited to Western blot detection of ACAT1 in human-derived samples, supporting studies of mitochondrial lipid metabolism and ketone body pathways. It enables assessment of ACAT1 expression levels in research examining metabolic regulation, enzyme function, and associated biochemical processes.
Sustainability
By rehoming surplus lab products, this listing supports waste reduction and resource efficiency.
