Anti-ACAT2
Overview
The Anti-ACAT2 antibody (HPA025811) is a Triple A Polyclonal reagent raised in rabbit and intended for immunohistochemical detection of human ACAT2, an enzyme involved in cholesterol esterification and lipid metabolic pathways. The antibody is generated using a recombinant protein fragment corresponding to a defined ACAT2 sequence region. Supplied in a stabilising buffer with glycerol and PBS, it is formulated for routine histological tissue staining workflows.
Highlights
- Rabbit Triple A Polyclonal antibody against human ACAT2
- Validated exclusively for immunohistochemistry (IHC)
- Produced using a recombinant human ACAT2 antigen fragment
- Supplied in PBS with glycerol and preservative for assay stability
At-a-glance
- Antigen
- ACAT2 (Acetyl-CoA acetyltransferase 2)
- Antibody type
- Triple A Polyclonal
- Host species
- Rabbit
- Isotype
- IgG
- Validation
- IHC only
- Immunogen sequence
- IIGSFNGALAAVPVQDLGSTVIKEVLKRATVAPEDVSEVIFGHVLAAGCGQNPVRQASVGAGIPYSVPAW
- Buffer composition
- 40% glycerol; PBS, pH 7.2; 0.02% sodium azide
- Condition
- New — none
Applications
This antibody is suited to immunohistochemical localisation of ACAT2 in human tissues, supporting investigations into lipid metabolism and cholesterol processing pathways. It can assist in mapping cell- and tissue-specific expression patterns relevant to metabolic physiology and disease models.
Sustainability
By rehoming surplus lab products, this listing supports waste reduction and resource efficiency.
