Anti-ACR
Overview
The Anti-ACR antibody (HPA048687) is a rabbit Triple A Polyclonal antibody directed against human acrosin, a serine protease involved in fertilisation-related processes within spermatozoa. The antigen is a recombinant protein fragment corresponding to a defined ACR sequence region. Supplied in a glycerol-containing PBS buffer with preservative, this antibody is validated exclusively for immunohistochemistry.
Highlights
- Rabbit Triple A Polyclonal antibody against human acrosin (ACR)
- Validated solely for IHC applications
- Generated using a defined recombinant ACR antigen fragment
- Formulated in PBS with glycerol and preservative for stability
At-a-glance
- Antigen
- ACR (acrosin)
- Antibody type
- Triple A Polyclonal
- Host species
- Rabbit
- Isotype
- IgG
- Validation
- IHC only
- Immunogen sequence
- LMEARVDLIDLDLCNSTQWYNGRVQPTNVCAGYPVGKIDTCQ
- Buffer composition
- 40% glycerol; PBS (pH 7.2); 0.02% sodium azide
- Condition
- New
Applications
This antibody supports immunohistochemical localisation of acrosin in human tissues, enabling studies of reproductive biology and sperm function. It is suited to investigations examining acrosomal enzyme expression patterns within developmental or physiological contexts.
Sustainability
By rehoming surplus lab products, this listing supports waste reduction and resource efficiency.
