Anti-ACSS1
Overview
The Anti-ACSS1 antibody (HPA043228) is a rabbit Triple A Polyclonal antibody developed to detect human ACSS1, an enzyme involved in mitochondrial acetate metabolism and acetyl-CoA production. The antibody is raised against a defined recombinant ACSS1 protein fragment, enabling sequence-specific target recognition. Supplied in an unconjugated format within a glycerol-containing PBS buffer, it is validated exclusively for Western blot analysis.
Highlights
- Rabbit Triple A Polyclonal antibody targeting human ACSS1
- Validated solely for Western blot (WB) applications
- Generated using a recombinant ACSS1 antigen fragment
- Formulated in PBS with glycerol and preservative
At-a-glance
- Antigen
- ACSS1 (acyl-CoA synthetase short-chain family member 1)
- Antibody type
- Triple A Polyclonal
- Host species
- Rabbit
- Isotype
- IgG
- Conjugate
- Unconjugated
- Validation
- Western blot (WB) only
- Immunogen sequence
- AQPGSYPALSAQAAREPAAFWGPLARDTLVWDTPYHTVWDCDFSTGKIGWFLGGQLNVSVNCLDQHVRKSPESVALIWERDEPGTEVRITYRELLETT
- Buffer composition
- 40% glycerol; PBS (pH 7.2); 0.02% sodium azide
- Condition
- New
Applications
This antibody is suited for Western blot detection of ACSS1 in human-derived samples, supporting studies of mitochondrial acetate utilisation and acetyl-CoA biosynthesis. It enables examination of ACSS1 expression patterns within metabolic, enzymatic, and biochemical research contexts.
Sustainability
By rehoming surplus lab products, this listing supports waste reduction and resource efficiency.
