Anti-ACSS2
Overview
The Anti-ACSS2 antibody (HPA004141) is a rabbit Triple A Polyclonal reagent targeting human ACSS2, an enzyme involved in acetate activation and acetyl-CoA synthesis. The antibody is produced using a recombinant protein fragment corresponding to a defined region of the ACSS2 sequence. Formulated in a glycerol-containing PBS buffer, it is validated exclusively for immunohistochemistry, enabling detection of ACSS2 in fixed tissue samples.
Highlights
- Rabbit Triple A Polyclonal antibody against human ACSS2
- Validated only for immunohistochemistry (IHC)
- Generated using a defined recombinant ACSS2 antigen fragment
- Supplied in PBS with glycerol and preservative
At-a-glance
- Antigen
- ACSS2 (acyl-CoA synthetase short-chain family member 2)
- Antibody type
- Triple A Polyclonal
- Host species
- Rabbit
- Isotype
- IgG
- Validation
- IHC only
- Immunogen sequence
- PGETTQITYHQLLVQVCQFSNVLRKQGIQKGDRVAIYMPMIPELVVAMLACARIGALHSIVFAGFSSESLCERILDSSCSLLITTDAFYRGEKLVNLKELADEALQKCQEKGFPVRCCIVVKHLGRAELGMGDSTSQSPPIKRSCPDVQ
- Buffer composition
- 40% glycerol; PBS (pH 7.2); 0.02% sodium azide
- Condition
- New
Applications
This antibody is suited for immunohistochemical localisation of ACSS2 in human tissues, supporting investigations into acetate metabolism, acetyl-CoA generation, and related metabolic pathways. It enables assessment of ACSS2 expression patterns in physiological and pathological contexts.
Sustainability
By rehoming surplus lab products, this listing supports waste reduction and resource efficiency.
