Anti-ADNP
Overview
The Anti-ADNP antibody (HPA006371) is a rabbit Triple A Polyclonal reagent directed against human ADNP, a protein implicated in chromatin regulation and neurodevelopment. The antibody is generated using a recombinant ADNP protein fragment that defines the antigenic region targeted. Supplied in an unconjugated format within a glycerol-containing PBS buffer, it is validated exclusively for Western blot analysis.
Highlights
- Rabbit Triple A Polyclonal antibody targeting human ADNP
- Validated solely for Western blot (WB) applications
- Generated using a defined recombinant ADNP antigen fragment
- Formulated in PBS with glycerol and preservative
At-a-glance
- Antigen
- ADNP (activity-dependent neuroprotective protein)
- Antibody type
- Triple A Polyclonal
- Host species
- Rabbit
- Isotype
- IgG
- Conjugate
- Unconjugated
- Validation
- Western blot (WB) only
- Immunogen sequence
- SGSPFDPVFEVEPKISNDNPEEHVLKVIPEDASESEEKLDQKEDGSKYETIHLTEEPTKLMHNASDSEVDQDDVVEWKDGASPSESGPGSQQVSDFEDNTCEMKPGTWSDESSQSEDARSSKPAAKKKATMQGDREQLKWKNSSYGKVEG
- Buffer composition
- 40% glycerol; PBS (pH 7.2); 0.02% sodium azide
- Condition
- New
Applications
This antibody supports Western blot detection of ADNP in human protein extracts, contributing to studies of chromatin regulation, neuronal development, and associated molecular pathways. It allows examination of ADNP expression patterns in developmental, physiological, and disease-related research contexts.
Sustainability
By rehoming surplus lab products, this listing supports waste reduction and resource efficiency.
