Anti-ALCAM
Overview
The Anti-ALCAM antibody (HPA010926) is a rabbit Triple A Polyclonal reagent developed to detect human ALCAM, an immunoglobulin superfamily adhesion molecule involved in cell–cell interactions, migration, and immune function. The antibody is generated using a recombinant protein fragment corresponding to a defined extracellular region of ALCAM. It is validated exclusively for immunohistochemistry and supplied in a stabilising buffer for routine tissue staining workflows.
Highlights
- Rabbit Triple A Polyclonal antibody against human ALCAM
- Validated only for immunohistochemistry (IHC)
- Recombinant antigen fragment defining target specificity
- Supplied in PBS with glycerol and preservative
At-a-glance
- Antigen
- ALCAM (activated leukocyte cell adhesion molecule)
- Antibody type
- Triple A Polyclonal
- Host species
- Rabbit
- Isotype
- IgG
- Validation
- IHC only
- Immunogen sequence
- NITLKCLGNGNPPPEEFLFYLPGQPEGIRSSNTYTLTDVRRNATGDYKCSLIDKKSMIASTAITVHYLDLSLNPSGEVTRQIGDALPVSCTISASRNATVVWMKDNIRLRSSPSFSSLHYQDAGNYVCETALQEVEGLKKR
- Buffer composition
- 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
- Condition
- New
Applications
This antibody supports immunohistochemical localisation of ALCAM in human tissues, facilitating studies on cell adhesion, immune system interactions, and tumour biology. It is suitable for examining ALCAM distribution across physiological and pathological states.
Sustainability
By rehoming surplus lab products, this listing supports waste reduction and resource efficiency.
