Anti-ALOX15
Overview
The Anti-ALOX15 antibody (HPA013859) is a rabbit Triple A Polyclonal reagent targeting human ALOX15, an enzyme involved in the oxygenation of polyunsaturated fatty acids and lipid mediator biosynthesis. Produced using a recombinant protein fragment corresponding to a defined region of the ALOX15 sequence, the antibody provides sequence-specific recognition suitable for immunodetection assays. It is validated exclusively for Western blot analysis and is supplied in a stabilising aqueous buffer.
Highlights
- Rabbit Triple A Polyclonal antibody against human ALOX15
- Validated only for Western blot (WB)
- Recombinant antigen fragment ensures defined target specificity
- Formulated in PBS with glycerol and preservative
At-a-glance
- Antigen
- ALOX15 (arachidonate 15-lipoxygenase)
- Antibody type
- Triple A Polyclonal
- Host species
- Rabbit
- Isotype
- IgG
- Conjugate
- Unconjugated
- Validation
- Western blot (WB) only
- Immunogen sequence
- RTVGEDPQGLFQKHREEELEERRKLYRWGNWKDGLILNMAGAKLYDLPVDERFLEDKRVDFEVSLAKGLADLAIKDSLNVLTCWKDLDDFNRIFWCGQSKLAERVRDSWKEDALFGYQ
- Buffer composition
- 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
- Condition
- New
Applications
This antibody supports Western blot detection of ALOX15 in human protein samples, enabling studies of lipid oxidation pathways, inflammatory processes, and the biochemical roles of lipoxygenases. It is suited for assessing ALOX15 expression in physiological and disease-related contexts.
Sustainability
By rehoming surplus lab products, this listing supports waste reduction and resource efficiency.
