Anti-ALOX5AP
Overview
The Anti-ALOX5AP antibody (HPA026592) is a rabbit Triple A Polyclonal reagent targeting human ALOX5AP, the arachidonate 5-lipoxygenase-activating protein essential for leukotriene biosynthesis. The antibody is generated using a recombinant protein fragment corresponding to a defined region of the ALOX5AP sequence, ensuring sequence-specific target recognition. It is validated exclusively for Western blot applications and supplied in a stabilising aqueous buffer.
Highlights
- Rabbit Triple A Polyclonal antibody against human ALOX5AP
- Validated only for Western blot (WB)
- Generated using a defined recombinant ALOX5AP antigen fragment
- Formulated in PBS with glycerol and preservative
At-a-glance
- Antigen
- ALOX5AP (arachidonate 5-lipoxygenase-activating protein)
- Antibody type
- Triple A Polyclonal
- Host species
- Rabbit
- Isotype
- IgG
- Conjugate
- Unconjugated
- Validation
- Western blot (WB) only
- Immunogen sequence
- HKVEHESRTQNGRSFQRTGTLAFERVYTANQNCVDAYPTFLAVL
- Buffer composition
- 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
- Condition
- New
Applications
This antibody enables Western blot detection of ALOX5AP in human protein samples, supporting studies of leukotriene biosynthesis, inflammatory signalling, and lipid mediator regulation. It is suitable for examining ALOX5AP expression patterns in physiological and disease-associated contexts.
Sustainability
By rehoming surplus lab products, this listing supports waste reduction and resource efficiency.
