Anti-ANKS6
Overview
The Anti-ANKS6 antibody (HPA008355) is a rabbit Triple A Polyclonal reagent targeting human ANKS6, a protein containing ankyrin repeat and sterile alpha motif domains implicated in cilia-associated signalling pathways. The antibody is produced using a recombinant ANKS6 protein fragment corresponding to a defined sequence region, enabling specific immunodetection. It is validated exclusively for Western blot applications and is supplied in a stabilising aqueous buffer.
Highlights
- Rabbit Triple A Polyclonal antibody targeting human ANKS6
- Validated only for Western blot (WB)
- Generated using a defined recombinant ANKS6 antigen fragment
- Formulated in PBS with glycerol and preservative
At-a-glance
- Antigen
- ANKS6 (ankyrin repeat and sterile alpha motif domain containing 6)
- Antibody type
- Triple A Polyclonal
- Host species
- Rabbit
- Isotype
- IgG
- Conjugate
- Unconjugated
- Validation
- Western blot (WB) only
- Immunogen sequence
- TSTTSKSTSPTLTPSPSPKGHTAESSVSSSSSHRQSKSSGGSSSGTITDEDELTGILKKLSLEKYQPIFEEQEVDMEAFLTLTDGDLKELGIKTDGSRQQILAAISELNAGKGRERQILQETIHNFHSSF
- Buffer composition
- 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
- Condition
- New
Applications
This antibody supports Western blot detection of ANKS6 in human protein samples, aiding studies on ciliary function, signal transduction pathways, and protein–protein interaction networks. It is suited for examining ANKS6 expression in both physiological and disease-related contexts.
Sustainability
By rehoming surplus lab products, this listing supports waste reduction and resource efficiency.
