Anti-ANO6
Overview
The Anti-ANO6 antibody (HPA038958) is a rabbit Triple A Polyclonal reagent targeting human ANO6, a membrane-associated protein involved in phospholipid scrambling and ion transport. The antibody is raised against a recombinant ANO6 protein fragment corresponding to a defined antigenic region. Validated exclusively for immunohistochemistry, it is suited for detecting ANO6 expression in fixed human tissues and is supplied in a stabilising aqueous buffer.
Highlights
- Rabbit Triple A Polyclonal antibody targeting human ANO6
- Validated only for immunohistochemistry (IHC)
- Generated using a defined recombinant ANO6 antigen fragment
- Formulated in PBS with glycerol and preservative
At-a-glance
- Antigen
- ANO6 (anoctamin 6)
- Antibody type
- Triple A Polyclonal
- Host species
- Rabbit
- Isotype
- IgG
- Validation
- IHC only
- Immunogen sequence
- EEDDDDGDIVLENLGQTIVPDLGSLESQHDFRTPEFEEFNGKPDSLFFNDGQRRIDFVLVYEDESRKETNKKGTNEKQRRKRQAYESNLICHGLQLEATRSVLD
- Buffer composition
- 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
- Condition
- New
Applications
This antibody supports immunohistochemical detection of ANO6 in human tissues, aiding studies of membrane transport processes, phospholipid scrambling activity, and associated signalling pathways. It is suitable for mapping ANO6 expression under physiological and pathological conditions.
Sustainability
By rehoming surplus lab products, this listing supports waste reduction and resource efficiency.
