Anti-ANXA10
Overview
The Anti-ANXA10 antibody (HPA005469) is a rabbit Triple A Polyclonal reagent targeting human annexin A10, a calcium-binding protein implicated in membrane dynamics and cellular regulatory processes. The antibody is generated using a recombinant ANXA10 protein fragment corresponding to a defined antigenic region, enabling sequence-specific recognition. It is validated exclusively for Western blot applications and is supplied in a stabilising aqueous buffer.
Highlights
- Rabbit Triple A Polyclonal antibody against human annexin A10 (ANXA10)
- Validated only for Western blot (WB)
- Produced using a defined recombinant ANXA10 antigen fragment
- Formulated in PBS with glycerol and preservative
At-a-glance
- Antigen
- ANXA10 (annexin A10)
- Antibody type
- Triple A Polyclonal
- Host species
- Rabbit
- Isotype
- IgG
- Conjugate
- Unconjugated
- Validation
- Western blot (WB) only
- Immunogen sequence
- PPLYDAHELWHAMKGVGTDENCLIEILASRTNGEIFQMREAYCLQYSNNLQEDIYSETSGHFRDTLMNLVQGTREEGYTDPAMAAQDAMVLWEACQQKTGEHKTMLQMILCNK
- Buffer composition
- 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
- Condition
- New
Applications
This antibody supports Western blot detection of ANXA10 in human protein samples, aiding investigations into annexin family functions, membrane-associated processes, and regulatory signalling pathways. It is suited for examining ANXA10 expression patterns in physiological and disease-related studies.
Sustainability
By rehoming surplus lab products, this listing supports waste reduction and resource efficiency.
