Anti-ANXA3
Overview
The Anti-ANXA3 antibody (HPA013398) is a rabbit Triple A Polyclonal reagent directed against human annexin A3, a calcium-dependent phospholipid-binding protein involved in membrane dynamics and cellular response pathways. Generated using a recombinant ANXA3 protein fragment corresponding to a defined antigenic region, this antibody provides sequence-specific recognition suitable for immunodetection workflows. It is validated exclusively for Western blot analysis and is supplied in a stabilising aqueous buffer.
Highlights
- Rabbit Triple A Polyclonal antibody against human annexin A3 (ANXA3)
- Validated only for Western blot (WB)
- Recombinant antigen fragment defining target specificity
- Supplied in PBS with glycerol and preservative
At-a-glance
- Antigen
- ANXA3 (annexin A3)
- Antibody type
- Triple A Polyclonal
- Host species
- Rabbit
- Isotype
- IgG
- Conjugate
- Unconjugated
- Validation
- Western blot (WB) only
- Immunogen sequence
- ISQAYYTVYKKSLGDDISSETSGDFRKALLTLADGRRDESLKVDEHLAKQDAQILYKAGENRWGTDEDKFTEILCLRSFPQLKLTFDEYRNISQKDIVDSIKGELSGHFEDLLLAIVNCVRNTPAFLAERLHRALKGIGTD
- Buffer composition
- 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
- Condition
- New
Applications
This antibody enables Western blot detection of ANXA3 in human protein samples, supporting studies of annexin-mediated membrane processes, intracellular signalling, and stress response pathways. It is suited for examining ANXA3 expression in physiological and pathological contexts.
Sustainability
By rehoming surplus lab products, this listing supports waste reduction and resource efficiency.
