Anti-API5
Overview
The Anti-API5 antibody (HPA026598) is a rabbit Triple A Polyclonal reagent targeting human API5, an apoptosis inhibitory protein involved in cell survival regulation and stress response pathways. The antibody is produced using a recombinant protein fragment corresponding to a defined region of the API5 sequence, enabling sequence-specific target recognition. It is validated exclusively for Western blot analysis and is supplied in a stabilising aqueous buffer.
Highlights
- Rabbit Triple A Polyclonal antibody against human API5
- Validated only for Western blot (WB)
- Generated using a defined recombinant API5 antigen fragment
- Formulated in PBS with glycerol and preservative
At-a-glance
- Antigen
- API5 (apoptosis inhibitor 5)
- Antibody type
- Triple A Polyclonal
- Host species
- Rabbit
- Isotype
- IgG
- Conjugate
- Unconjugated
- Validation
- Western blot (WB) only
- Immunogen sequence
- TVEELYRNYGILADATEQVGQHKDAYQVILDGVKGGTKEKRLAAQFIPKFFKHFPELADSAINAQLDLCEDEDVSIRRQAIKELPQFATGENLPRVADILTQLLQTDDSAEFNLVN
- Buffer composition
- 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
- Condition
- New
Applications
This antibody supports Western blot detection of API5 in human-derived protein samples, aiding studies of apoptosis regulation, cell survival pathways, and stress-mediated signalling mechanisms. It is suitable for examining API5 expression in physiological and pathological research contexts.
Sustainability
By rehoming surplus lab products, this listing supports waste reduction and resource efficiency.
