Anti-APOA1
Overview
The Anti-APOA1 antibody (HPA046715) is a rabbit Triple A Polyclonal reagent targeting human apolipoprotein A-I (APOA1), the major protein component of high-density lipoprotein involved in lipid transport and cholesterol homeostasis. The antibody is generated using a recombinant APOA1 protein fragment corresponding to a defined antigenic region, providing sequence-specific detection capability. It is validated exclusively for Western blot applications and supplied in a stabilising aqueous buffer.
Highlights
- Rabbit Triple A Polyclonal antibody against human APOA1
- Validated only for Western blot (WB)
- Recombinant antigen fragment defining target specificity
- Formulated in PBS with glycerol and preservative
At-a-glance
- Antigen
- APOA1 (apolipoprotein A-I)
- Antibody type
- Triple A Polyclonal
- Host species
- Rabbit
- Isotype
- IgG
- Conjugate
- Unconjugated
- Validation
- Western blot (WB) only
- Immunogen sequence
- SKLREQLGPVTQEFWDNLEKETEGLRQEMSKDLEEVKAKVQPYLDDFQKKWQEEMELYRQKVEPLRAELQEGARQKLHELQEKL
- Buffer composition
- 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
- Condition
- New
Applications
This antibody enables Western blot detection of APOA1 in human-derived protein samples, supporting studies of lipid transport, cholesterol metabolism, and lipoprotein-associated pathways. It is suited for examining APOA1 expression in physiological and disease-related contexts.
Sustainability
By rehoming surplus lab products, this listing supports waste reduction and resource efficiency.
