Anti-APOE
Overview
The Anti-APOE antibody (HPA065539) is a rabbit Triple A Polyclonal reagent directed against human apolipoprotein E (APOE), a key protein in lipoprotein metabolism and cholesterol transport. The antibody is generated using a recombinant APOE protein fragment corresponding to a defined sequence region, supporting sequence-specific target recognition. It is available in formats validated for Western blot and immunohistochemistry, enabling detection of APOE in both protein extracts and fixed tissue sections.
Highlights
- Rabbit Triple A Polyclonal antibody against human apolipoprotein E (APOE)
- Recombinant antigen fragment defining the target epitope
- Formats validated for Western blot (WB) and immunohistochemistry (IHC)
- Formulated in a stabilising aqueous buffer suitable for routine use
At-a-glance
- Antigen
- APOE (apolipoprotein E)
- Antibody type
- Triple A Polyclonal
- Host species
- Rabbit
- Isotype
- IgG
- Conjugate
- Unconjugated
- Validated applications
- Western blot (WB); immunohistochemistry (IHC)
- Immunogen sequence
- ARMEEMGSRTRDRLDEVKEQVAEVRAKLEEQAQQIRLQAEAFQARLKSWFEPLVEDMQRQW
- Buffer composition
- 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
- Condition
- New
Applications
This antibody can be used to detect APOE in human protein samples by Western blot, facilitating studies of lipoprotein metabolism, cholesterol transport, and related biochemical pathways. It is also suited to immunohistochemical localisation of APOE in tissue sections, supporting investigations into its distribution in physiological and disease-associated contexts, including neurological and cardiovascular research models.
Sustainability
By rehoming surplus lab products, this listing supports waste reduction and resource efficiency.

