Anti-BAIAP2
Overview
This Anti-BAIAP2 antibody entry represents a combined description for the HPA023310 series, consisting of rabbit Triple A Polyclonal antibodies targeting human BAI1-associated protein 2 (BAIAP2), an adaptor protein involved in actin cytoskeleton organisation, membrane curvature regulation, and signal transduction. The antibodies in this series are generated using an identical recombinant antigen fragment, producing sequence-specific recognition. Formats validated for Western blot and immunohistochemistry are available, supporting both lysate-based and tissue-based detection of BAIAP2.
Highlights
- Rabbit Triple A Polyclonal antibodies recognising human BAIAP2
- Validated formats for Western blot (WB) and immunohistochemistry (IHC)
- Defined recombinant antigen fragment ensuring consistent target specificity
- Formulated in PBS with glycerol and preservative
At-a-glance
- Antigen
- BAIAP2 (BAI1-associated protein 2)
- Antibody type
- Triple A Polyclonal
- Host species
- Rabbit
- Isotype
- IgG
- Validated applications
- Western blot (WB); immunohistochemistry (IHC)
- Immunogen sequence
- WFPFSYTRVLDSDGSDRLHMSLQQGKSSSTGNLLDKDDLAIPPPDYGAASRAFPAQTASGFKQRPYSVAVPAFSQGLDDYGARSMSRNP
- Buffer composition
- 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
- Condition
- New
Applications
These antibodies enable detection of BAIAP2 across human research samples. Western blot formats support analysis of protein expression and size in lysates, while IHC-validated formats allow localisation of BAIAP2 within fixed tissues. Together, they aid investigations into actin-associated scaffolding complexes, membrane protrusion dynamics, and signalling pathways regulating cytoskeletal reorganisation.
Sustainability
By rehoming surplus lab products, this listing supports waste reduction and resource efficiency.
