Anti-FAT4 Rabbit Polyclonal Antibody
Overview
This rabbit polyclonal antibody is raised against a protein sequence from human FAT4 (FAT atypical cadherin 4). It is part of the Atlas Antibodies Triple A Polyclonals range and is intended for detection of endogenous FAT4 in human tissues. The manufacturer reports validation of this antibody for immunohistochemistry applications.
Highlights
- Rabbit polyclonal antibody targeting human FAT4
- Validated application: immunohistochemistry (IHC)
- Immunogen derived from a defined human protein sequence
- Supplied in glycerol-containing phosphate buffer
At-a-glance
- Target protein
- FAT4 (FAT atypical cadherin 4)
- Host species
- Rabbit
- Clonality
- Polyclonal
- Validated applications
- Immunohistochemistry (IHC)
- Immunogen sequence
- FDDPDNIPPYGDDMTVRKQPEGNPKPDIIERENPYLIYDETDIPHNSETIPSAPLASPEQEIEHYDIDNASSIAPSDADIIQHYKQFRSHT
- Buffer composition
- 40% glycerol, PBS (pH 7.2), 0.02% sodium azide
- Condition
- New / Unused — The product is only validated for IHC application
Applications
This antibody is intended for immunohistochemical detection of FAT4 in human tissue samples. It may support studies of FAT4 localisation and expression patterns in research contexts. The manufacturer does not report validation for applications other than IHC.
Sustainability
By rehoming surplus lab products, this listing supports waste reduction and resource efficiency.
